DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG30375

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster


Alignment Length:248 Identity:77/248 - (31%)
Similarity:122/248 - (49%) Gaps:30/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHS--CGGSIISKQFVMTAAHCTDGRK-ASDLSVQYGVTKI 90
            |:.||.::...::|.::.:|..|.:..  |||||:|::::|||||||..:. ||.|....|...:
  Fly   151 RIANGVEAGKHEFPSMVGLRDLSSNLPIFCGGSIVSERYIMTAAHCTARQPVASRLLALVGEHDL 215

  Fly    91 NATGPNVV-----RVKKIIQHEDY-NPYNNYANDISLLLVEEPFEFDGVTVAPVKLP----ELAF 145
             :||...:     |::.||.|..| ...:...|||:||....|.|:.. .|||:.||    |.:|
  Fly   216 -STGAESIYAAQYRIQNIINHPGYMETASGNINDIALLQTATPIEWSR-GVAPICLPIRQAENSF 278

  Fly   146 ATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGK 210
            .....|      ::|||.........:|||:..|....:..|..|......|. |:| ..|.||:
  Fly   279 NYQNVD------IMGWGTLGFAASKSNTLQKATLLTMDNAVCRSRFNSSITPS-HLC-TYDAGGR 335

  Fly   211 GQ--CSGDSGGPLIYNGQ----QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            ||  |..|||||:|...:    |:|::|:. :.|......||..:|:.:::|:
  Fly   336 GQDSCQYDSGGPVILRQRERMFQLGVISYG-RACGQPFGIGVNTRVTSHLNWL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 76/246 (31%)
Tryp_SPc 30..259 CDD:238113 76/247 (31%)
CG30375NP_724665.1 CUB 38..>100 CDD:294042
Tryp_SPc 151..386 CDD:214473 76/245 (31%)
Tryp_SPc 152..387 CDD:238113 75/245 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456017
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.