DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG30025

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster


Alignment Length:238 Identity:84/238 - (35%)
Similarity:120/238 - (50%) Gaps:18/238 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQM-GRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVT 88
            ||: ||:|.|:.:::..:|:.||:: .||||||||||.|...::|||||.....||.|.::.| :
  Fly    25 PQLDGRIVGGSATTISSFPWQISLQ-RSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAG-S 87

  Fly    89 KINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAG 153
            ...::|.....|.....||.||. |...|||:::.:.....|.    :.:|...||.:.|..  |
  Fly    88 SYWSSGGVTFSVSSFKNHEGYNA-NTMVNDIAIIKINGALTFS----STIKAIGLASSNPAN--G 145

  Fly   154 GEGVLIGWG-LNATGGYIQSTLQEVELKVYSDEEC---TERHGGRTDPRYHICGGVDEGGKGQCS 214
            ....:.||| |:.....|.|.||.|.:.:.|..:|   |..:|.:..... ||...  .||..|.
  Fly   146 AAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTM-ICAAA--SGKDACQ 207

  Fly   215 GDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            |||||||:..|..||:|||.. .|..:.|||||..|:....|:
  Fly   208 GDSGGPLVSGGVLVGVVSWGY-GCAYSNYPGVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 80/231 (35%)
Tryp_SPc 30..259 CDD:238113 80/232 (34%)
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 80/231 (35%)
Tryp_SPc 31..252 CDD:238113 80/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
44.020

Return to query results.
Submit another query.