DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk7

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_036002.1 Gene:Klk7 / 23993 MGIID:1346336 Length:249 Species:Mus musculus


Alignment Length:250 Identity:76/250 - (30%)
Similarity:118/250 - (47%) Gaps:26/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKAS 79
            |.|||      |..|:::|.......:|:.:::...:..| |||.::.|.:|:|||||    |..
Mouse    17 LETAG------QGERIIDGYKCKEGSHPWQVALLKGNQLH-CGGVLVDKYWVLTAAHC----KMG 70

  Fly    80 DLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELA 144
            ...||.|..||.......::..|..:|..|:. ..:.|||.|:.::||.:... .|..|:|||  
Mouse    71 QYQVQLGSDKIGDQSAQKIKATKSFRHPGYST-KTHVNDIMLVRLDEPVKMSS-KVEAVQLPE-- 131

  Fly   145 FATPQTDAGGEGVLIGWGLNATGGY-IQSTLQEVELKVYSDEECTERHG---GRTDPRYHICGGV 205
            ...|   .|....:.|||...:... ..|.|...::|:.|..||.:.:.   |:|    .:|.|:
Mouse   132 HCEP---PGTSCTVSGWGTTTSPDVTFPSDLMCSDVKLISSRECKKVYKDLLGKT----MLCAGI 189

  Fly   206 DEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKS 260
            .:.....|:|||||||:.|....|:|||...||.....||||.:|.:|..|:.::
Mouse   190 PDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYKRWVMET 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 70/231 (30%)
Tryp_SPc 30..259 CDD:238113 70/232 (30%)
Klk7NP_036002.1 Tryp_SPc 25..241 CDD:214473 70/231 (30%)
Serine protease. /evidence=ECO:0000250 26..246 70/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0U
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42512
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.