DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Habp2

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001316864.1 Gene:Habp2 / 226243 MGIID:1196378 Length:554 Species:Mus musculus


Alignment Length:256 Identity:80/256 - (31%)
Similarity:122/256 - (47%) Gaps:43/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGS-------SGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYG 86
            |:..|..|:..|:|:.:|::.|       ...|.|||::|...:|:||||||| .....|.|..|
Mouse   307 RIYGGFKSTAGKHPWQVSLQTSLPLTTSMPQGHFCGGALIHPCWVLTAAHCTD-INTKHLKVVLG 370

  Fly    87 VTKINATGPN--VVRVKKIIQHEDYNPYNNYA-NDISLLLVEEPF----EFDGVTVAPVKLPELA 144
            ...:..|..:  ..||:||:::..||..:... |||:||.: :|.    ..:...|..|.||...
Mouse   371 DQDLKKTESHEQTFRVEKILKYSQYNERDEIPHNDIALLKL-KPVGGHCALESRYVKTVCLPSDP 434

  Fly   145 FATPQTDAGGEGVLIGWGLNATG-GYIQSTLQEVELKVYSDEECTER--HGGRTDPRYHICGGVD 206
            |     .:|.|..:.|||:..|| |..|  |.:.::|:.::..|..|  :....|......|.:.
Mouse   435 F-----PSGTECHISGWGVTETGEGSRQ--LLDAKVKLIANPLCNSRQLYDHTIDDSMICAGNLQ 492

  Fly   207 EGGKGQCSGDSGGPL---------IYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            :.|...|.|||||||         :|     |||||. :.|  ...||||.:|:::::|||
Mouse   493 KPGSDTCQGDSGGPLTCEKDGTYYVY-----GIVSWG-QEC--GKKPGVYTQVTKFLNWIK 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 77/253 (30%)
Tryp_SPc 30..259 CDD:238113 79/255 (31%)
Habp2NP_001316864.1 EGF_CA 67..103 CDD:238011
EGF_CA 150..182 CDD:238011
KR 187..271 CDD:238056
Tryp_SPc 308..547 CDD:238113 79/255 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.