DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Prss38

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:258 Identity:72/258 - (27%)
Similarity:121/258 - (46%) Gaps:36/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ISHGAPQM-GRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTD-GRKASDLS 82
            ::.|.|.: |:::.|..:...|:|:.:|:. .||.|.|||||:|..:|::||||.| |:|.....
Mouse    45 VACGQPVLQGKLLGGEFARDRKWPWQVSLH-YSGFHICGGSILSAYWVLSAAHCFDRGKKLETYD 108

  Fly    83 VQYGVTKINATGPNV--VRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLP---- 141
            :..|:|.:.....:.  ..:.::|.|..:..|:....|::|:.::....|... |.|:.||    
Mouse   109 IYVGITNLEKANRHTQWFEIYQVIIHPTFQMYHPIGGDVALVQLKSAIVFSDF-VLPICLPPSDL 172

  Fly   142 ---ELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRY---- 199
               .|:..|           .|||:.:..|...:.|.|.:|.:....:|...:|..:   |    
Mouse   173 YLINLSCWT-----------TGWGMISPQGETGNELLEAQLPLIPRFQCQLLYGLSS---YLLPE 223

  Fly   200 HICGGVDEGGKGQCSGDSGGPLIYNGQ----QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            .:|....:..|..|.||||.||:....    |:|||||. :.|....||||:..||.::.||:
Mouse   224 MLCAADIKTMKNVCEGDSGSPLVCKQNQTWLQIGIVSWG-RGCAQPLYPGVFANVSYFLSWIR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 67/245 (27%)
Tryp_SPc 30..259 CDD:238113 69/247 (28%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 69/245 (28%)
Tryp_SPc 58..284 CDD:214473 67/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.