DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk1b4

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_035045.2 Gene:Klk1b4 / 18048 MGIID:97320 Length:256 Species:Mus musculus


Alignment Length:268 Identity:81/268 - (30%)
Similarity:120/268 - (44%) Gaps:36/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVFALLTTAGISHGAPQMGRV--VNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAH 71
            |.:|..|:..||....|...:|  .|.....|..|.|        ..:.|||.::.:.:|:||||
Mouse     4 LILFLALSLGGIDAAPPVQSQVDCENSQPWHVAVYRF--------NKYQCGGVLLDRNWVLTAAH 60

  Fly    72 CTDGRKASDLSVQYGVTKINATGPNVVR--VKKIIQHEDYN----------PYNNYANDISLLLV 124
            |.:.:    ..|..|........|:...  |.|.|.|.|:|          |.::|:||:.||.:
Mouse    61 CYNDK----YQVWLGKNNFLEDEPSDQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRL 121

  Fly   125 EEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGY-IQSTLQEVELKVYSDEECT 188
            .:|.:...| |.|:.||     |.:...|...:..|||......: ....||.|.||:..:|:|.
Mouse   122 SKPADITDV-VKPITLP-----TEEPKLGSTCLASGWGSTTPIKFKYPDDLQCVNLKLLPNEDCD 180

  Fly   189 ERHGGR-TDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQ 252
            :.|..: ||..  :|.|..:||...|..|||||||.:|...||.||..:||.....|.||.|:.:
Mouse   181 KAHEMKVTDAM--LCAGEMDGGSYTCEHDSGGPLICDGILQGITSWGPEPCGEPTEPSVYTKLIK 243

  Fly   253 YVDWIKKS 260
            :..||:::
Mouse   244 FSSWIRET 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 73/243 (30%)
Tryp_SPc 30..259 CDD:238113 75/244 (31%)
Klk1b4NP_035045.2 Tryp_SPc 13..251 CDD:238113 78/257 (30%)
Activation peptide homolog 18..24 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.