DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Mcpt8

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_032598.1 Gene:Mcpt8 / 17231 MGIID:1261780 Length:247 Species:Mus musculus


Alignment Length:263 Identity:78/263 - (29%)
Similarity:122/263 - (46%) Gaps:28/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFV--ISMRGSSGSHSCGGSIISKQFVMTA 69
            |.|.|.||...|       :.|.::.||:|.....|::  |....|...:.|||.::::..||||
Mouse     5 LVLLVAALPVNA-------EGGEIIWGTESKPHSRPYMAYIRFNDSKSVYRCGGFLVARDIVMTA 62

  Fly    70 AHCTDGRKASDLSVQYGVTKI-NATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGV 133
            ||| :|:.   ::|..|:..: ......::.|.:.|.||.:: .....|||.||.:|...:.:. 
Mouse    63 AHC-NGKV---INVTLGIHNLKKKKNTQLIPVSEAIPHESFD-NETLVNDIMLLKLERKAQLNS- 121

  Fly   134 TVAPVKLPELAFATPQTDAGGEGVLIGWG--LNATGGYIQSTLQEVELKVYSDEECTERHGGRTD 196
            .|..:.||:   :......|....:.|||  .|.|   :..|||||.|:|...::|........|
Mouse   122 AVDTIALPK---SKDWVKPGQVCTVAGWGKLANCT---LSDTLQEVNLEVQKGQKCRSMSQTYND 180

  Fly   197 PRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKSQ 261
             ...:|.|.....|....||||||.:.||...||||..:  || ...|.|:.::|.::.||:|:.
Mouse   181 -SIQLCVGNPSENKATGKGDSGGPFVCNGVVQGIVSCRL--CT-GTLPRVFTRISSFMPWIRKTM 241

  Fly   262 IIL 264
            .:|
Mouse   242 KLL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 67/232 (29%)
Tryp_SPc 30..259 CDD:238113 69/233 (30%)
Mcpt8NP_032598.1 Tryp_SPc 20..237 CDD:214473 67/232 (29%)
Tryp_SPc 21..240 CDD:238113 69/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.