DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk1b24

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_034773.1 Gene:Klk1b24 / 16617 MGIID:892021 Length:263 Species:Mus musculus


Alignment Length:268 Identity:85/268 - (31%)
Similarity:121/268 - (45%) Gaps:33/268 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCT 73
            |.:|..|:..||....|...|||.|........|:.::: .....:.|||.:::..:|:|||||.
Mouse     4 LILFLALSLGGIDAAPPVQSRVVGGFKCEKNSQPWHVAV-FRYNKYICGGVLLNPNWVLTAAHCY 67

  Fly    74 DGRKASDLSVQYGVTKINATGPNVVR--VKKIIQHEDYN--------PY-NNYANDISLLLVEEP 127
             |...|..:|..|..|:....|:...  |.|...|.|||        |. .:.:||:.||.:.||
Mouse    68 -GNATSQYNVWLGKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDDIPQPKDKSNDLMLLRLSEP 131

  Fly   128 FEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWG-LNATGGYIQSTLQEVELKVYSDEECTERH 191
            .:... .|.|:.||     |.:...|...:..||| :..|.....:.||.|.:|:..:|.||:  
Mouse   132 ADITD-AVKPIDLP-----TEEPKLGSTCLASGWGSITPTKWQKPNDLQCVFIKLLPNENCTK-- 188

  Fly   192 GGRTDPRYH------ICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKV 250
                 |..|      :|.|...|||..|:||||||||.:|...||.||...||.....|.:|.|:
Mouse   189 -----PYLHKVTDVMLCAGEMGGGKDTCAGDSGGPLICDGILHGITSWGPVPCGKPNAPAIYTKL 248

  Fly   251 SQYVDWIK 258
            .::..|||
Mouse   249 IKFASWIK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 76/245 (31%)
Tryp_SPc 30..259 CDD:238113 78/247 (32%)
Klk1b24NP_034773.1 Tryp_SPc 24..255 CDD:214473 76/245 (31%)
Tryp_SPc 25..258 CDD:238113 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.