DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk1b11

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_034770.1 Gene:Klk1b11 / 16613 MGIID:892023 Length:261 Species:Mus musculus


Alignment Length:264 Identity:85/264 - (32%)
Similarity:125/264 - (47%) Gaps:27/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCT 73
            |.:|..|:..||....|...|:|.|.:......|:.:::. ....:.|||.::.:.:|:||||| 
Mouse     4 LILFLALSLGGIDAAPPVQSRIVGGFNCEKNSQPWHVAVY-RYNKYICGGVLLDRNWVLTAAHC- 66

  Fly    74 DGRKASDLSVQYGVTKINATGPNVVR--VKKIIQHEDYN----------PYNNYANDISLLLVEE 126
               ..|..:|..|.||:....|:...  |.|...|.|||          |.::.:||:.||.:.|
Mouse    67 ---HVSQYNVWLGKTKLFQREPSAQHRMVSKSFPHPDYNMSLLIIHNPEPEDDESNDLMLLRLSE 128

  Fly   127 PFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWG-LNATGGYIQSTLQEVELKVYSDEECTER 190
            |.:... .|.|:.||     |.:...|...::.||| :..|.......||.|.:|:..:|.|.:.
Mouse   129 PADITD-AVKPIALP-----TEEPKLGSTCLVSGWGSITPTKFQTPDDLQCVSIKLLPNEVCVKN 187

  Fly   191 HGGR-TDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYV 254
            |..: ||  ..:|.|...|||..|.||||||||.:|...||.:|...||.....||||.|:.::.
Mouse   188 HNQKVTD--VMLCAGEMGGGKDTCKGDSGGPLICDGVLHGITAWGPIPCGKPNTPGVYTKLIKFT 250

  Fly   255 DWIK 258
            :|||
Mouse   251 NWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 76/241 (32%)
Tryp_SPc 30..259 CDD:238113 78/243 (32%)
Klk1b11NP_034770.1 Tryp_SPc 24..253 CDD:214473 76/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.