DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Prss28

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:280 Identity:78/280 - (27%)
Similarity:125/280 - (44%) Gaps:51/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CLAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMR-----GSSGSHSCGGSIISKQFVM 67
            ||.....:.:..||...| :| :|.|..:...|:|:.:|:|     .:|..|.||||||..|:::
Mouse    11 CLESTVFMASVSISRSKP-VG-IVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIHPQWIL 73

  Fly    68 TAAHCTDGRKASD--LSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYAN----DISLLLVEE 126
            |||||...:.|..  ..||.|...:... ..::.:.:||.|.|||..:...:    .::.|||  
Mouse    74 TAAHCIQSQDADPAVYRVQVGEVYLYKE-QELLNISRIIIHPDYNDVSKRFDLALMQLTALLV-- 135

  Fly   127 PFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQST-------LQEVELKVYSD 184
                ....|:||.||:.:.....||   :..|:||     |..:|..       |.||::.:..:
Mouse   136 ----TSTNVSPVSLPKDSSTFDSTD---QCWLVGW-----GNLLQRVPLQPPYQLHEVKIPIQDN 188

  Fly   185 EECTERHGGRTDPRYH--------ICGGVDEGGKGQCSGDSGGPLI----YNGQQVGIVSWSIKP 237
            :.|...:..::...:.        :|.|.  .|:|.|.|||||||:    ....|||:||..| .
Mouse   189 KSCKRAYRKKSSDEHKAVAIFDDMLCAGT--SGRGPCFGDSGGPLVCWKSNKWIQVGVVSKGI-D 250

  Fly   238 CTVAPYPGVYCKVSQYVDWI 257
            |: ...|.::.:|...:.||
Mouse   251 CS-NNLPSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 70/257 (27%)
Tryp_SPc 30..259 CDD:238113 72/258 (28%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 72/258 (28%)
Tryp_SPc 31..269 CDD:214473 70/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.