DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Prss1

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_444473.1 Gene:Prss1 / 114228 MGIID:98839 Length:246 Species:Mus musculus


Alignment Length:251 Identity:84/251 - (33%)
Similarity:124/251 - (49%) Gaps:18/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDG 75
            :|..|..|.::.......::|.|........|:.:|:  :||.|.||||:|:.|:|::||||...
Mouse     5 LFLALVGAAVAFPVDDDDKIVGGYTCRENSVPYQVSL--NSGYHFCGGSLINDQWVVSAAHCYKT 67

  Fly    76 RKASDLSVQYGVTKINATGPN--VVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPV 138
            |    :.|:.|...||....|  .:...|||:|.::| .....|||.|:.:..|...: ..||.|
Mouse    68 R----IQVRLGEHNINVLEGNEQFIDAAKIIKHPNFN-RKTLNNDIMLIKLSSPVTLN-ARVATV 126

  Fly   139 KLPELAFATPQTDAGGEGVLIGWGLNATGGYIQ-STLQEVELKVYSDEECTERHGGRTDPRYHIC 202
            .||...     ..||.:.::.|||...:.|..: ..||.::..:....:|...:.|:..... :|
Mouse   127 ALPSSC-----APAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASYPGKITGNM-VC 185

  Fly   203 GGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            .|..||||..|.||||||::.||:..|||||.. .|.:...||||.||..|||||:
Mouse   186 AGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGY-GCALPDNPGVYTKVCNYVDWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 79/230 (34%)
Tryp_SPc 30..259 CDD:238113 81/232 (35%)
Prss1NP_444473.1 Tryp_SPc 23..239 CDD:214473 79/230 (34%)
Tryp_SPc 24..242 CDD:238113 81/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.