DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and PRSS21

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:299 Identity:90/299 - (30%)
Similarity:138/299 - (46%) Gaps:68/299 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAVFALLTTAGI-----SHGAPQMG---------RVVNGTDSSVEKYPFVISMRGSSGSHSCG 57
            |.||:  ||..||:     ...||..|         |:|.|.|:.:.::|:..|:| ...||.||
Human     7 LLLAL--LLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLR-LWDSHVCG 68

  Fly    58 GSIISKQFVMTAAHCTDGRKASDLS------VQYG-VTKINA--------TGPNVVRVKKIIQHE 107
            .|::|.::.:|||||.:  ..||||      ||:| :|.:.:        |...|..:....::.
Human    69 VSLLSHRWALTAAHCFE--TYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYL 131

  Fly   108 DYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFA-TPQTDAGGEGVLIGWGLNATGGYIQ 171
            ..:||     ||:|:.:..|..:. ..:.|:.|....|. ..:||..    :.||      |||:
Human   132 GNSPY-----DIALVKLSAPVTYT-KHIQPICLQASTFEFENRTDCW----VTGW------GYIK 180

  Fly   172 S--------TLQEVELKVYSDEECTE---RHGGRTDP-RYHICGGVDEGGKGQCSGDSGGPLIYN 224
            .        |||||::.:.::..|..   ::..|.|. ...:|.|..:|||..|.|||||||..|
Human   181 EDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACN 245

  Fly   225 GQ----QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKK 259
            ..    |:|:|||.: .|.....||||..:|.:.:||:|
Human   246 KNGLWYQIGVVSWGV-GCGRPNRPGVYTNISHHFEWIQK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 77/259 (30%)
Tryp_SPc 30..259 CDD:238113 78/260 (30%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 78/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.