DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and LOC103908930

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001373362.1 Gene:LOC103908930 / 103908930 -ID:- Length:243 Species:Danio rerio


Alignment Length:249 Identity:83/249 - (33%)
Similarity:130/249 - (52%) Gaps:19/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDG 75
            |||||.   ::.....:.:::.|.:......|:.|.:. :.|...||.|:|::.:.::||||..|
Zfish     5 VFALLV---VNVACSPVDKIIGGYECPPNSQPWQIYIT-NDGQRWCGASLINESWAVSAAHCNIG 65

  Fly    76 RKASDLSVQYGVTKINATGPNV--VRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPV 138
              |:.|:|..|...|:......  :|.:|:..|.::. :.:..|||.|:.:::|..|:.. |.|:
Zfish    66 --ANLLTVYLGKHNIDVVEKTEQRIRTEKVFPHPEFK-FPSEDNDIMLIKLKDPAVFNQY-VQPI 126

  Fly   139 KLPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICG 203
            .|     ||..:..|.:.::.|||....|  :.|.||.::|.|.|.:|| ||.......:..:|.
Zfish   127 PL-----ATSCSSEGEQCLVSGWGYTEVG--LPSVLQCLDLAVQSRQEC-ERVYKDKFTQNMLCA 183

  Fly   204 GVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            |..|||||.|.|||||||:.||:..|:|||. ..|....||.||.:|.:|.|||
Zfish   184 GFMEGGKGVCHGDSGGPLVCNGELRGVVSWG-AGCAEPGYPAVYVEVCRYSDWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 76/229 (33%)
Tryp_SPc 30..259 CDD:238113 78/230 (34%)
LOC103908930NP_001373362.1 Tryp_SPc 21..239 CDD:238113 78/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.