DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk9

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:212 Identity:66/212 - (31%)
Similarity:106/212 - (50%) Gaps:19/212 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 CGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKI-NATGP-NVVRVKKIIQHEDYNP---YNNY 115
            ||.::|:.|:::|||||   ||.. |.|:.|...: ...|| .::.|.....|..:||   .|::
Mouse    48 CGATLINDQWLLTAAHC---RKPY-LWVRLGEHHLWRWEGPEQLLLVTDFFPHPGFNPDLSANDH 108

  Fly   116 ANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQ--STLQEVE 178
            .:||.|:.:...     |.:.|...| |.....:...|.:.::.||| :.:...:|  .|||...
Mouse   109 NDDIMLIRLPRK-----VRLTPAVQP-LNLTESRPPVGTQCLISGWG-SVSSSKLQYPMTLQCAN 166

  Fly   179 LKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPY 243
            :.:..::.|...:.|....:. :|.|:.|||:|.|.|||||||:..|...||||...:||:....
Mouse   167 ISILDNKLCRWAYPGHISEKM-LCAGLWEGGRGSCQGDSGGPLVCEGTLAGIVSGGSEPCSRPRR 230

  Fly   244 PGVYCKVSQYVDWIKKS 260
            |.||..|..|::||:.:
Mouse   231 PAVYTNVFDYLEWIEST 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 64/207 (31%)
Tryp_SPc 30..259 CDD:238113 66/209 (32%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 66/210 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.