DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and LOC100498083

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_012810073.2 Gene:LOC100498083 / 100498083 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:236 Identity:78/236 - (33%)
Similarity:121/236 - (51%) Gaps:20/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINAT 93
            :::.|...:....|:::|:  ::|.|.||||:|:.|:|::||||..    :.:.|:.|...|..:
 Frog    20 KIIGGATCAKNSVPYIVSL--NAGYHFCGGSLINNQWVVSAAHCYQ----ASVQVRLGEHNIAVS 78

  Fly    94 --GPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEG 156
              ....:...|:|:|..||. ....|||.|:.:......:. .|..|.||....|     ||...
 Frog    79 EGTEQFINSAKVIRHSGYNS-RTLDNDIMLIKLSSAASLNS-AVNAVALPSSCAA-----AGTSC 136

  Fly   157 VLIGWG-LNATGGYIQSTLQEVELKVYSDEECTERHGGR-TDPRYHICGGVDEGGKGQCSGDSGG 219
            ::.||| .:|:|....:.||.:...:.:..:|:..:.|: |:..:  |.|..||||..|.|||||
 Frog   137 LISGWGNTSASGSNYPNLLQCLNAPILTTAQCSGAYPGQITNNMF--CAGFLEGGKDSCQGDSGG 199

  Fly   220 PLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKS 260
            |::.|||..|||||.| .|....|||||.||..|..||:.:
 Frog   200 PVVCNGQLQGIVSWGI-GCAQRNYPGVYTKVCNYNSWIQST 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 76/231 (33%)
Tryp_SPc 30..259 CDD:238113 78/232 (34%)
LOC100498083XP_012810073.2 Tryp_SPc 21..239 CDD:238113 78/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.