DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:283 Identity:89/283 - (31%)
Similarity:138/283 - (48%) Gaps:44/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DLCLAVFALLTTAGISH------GAPQMG-RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISK 63
            |.||.:|.:.|  |:|.      |.|.:| |:|.|.::|...:|:.:.::..|..|.||||||:|
Zfish     3 DSCLQLFLMAT--GLSTCLAQVCGRPPLGKRIVGGVEASPGSWPWQVDIQMGSNGHVCGGSIIAK 65

  Fly    64 QFVMTAAHC-TDGRKASDLSVQYGVTKINATGPN----VVRVKKIIQHEDY-NPYNNYANDISLL 122
            .:|::|||| .:..:.|..::..|...:|  |.|    |..|::::..|.| :|..  ..|::|:
Zfish    66 NWVLSAAHCFPNPSEVSAYTLYMGRHLLN--GYNQFEKVSYVQRVVIPEGYTDPQG--GRDVALV 126

  Fly   123 LVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGW-----GLNATGGYIQSTLQEVELKVY 182
            .:..|..:.. .:.||.||   ||..|.::|....:.||     |::.||.   :.|:|||:.:.
Zfish   127 QLRAPVSWTD-RIQPVCLP---FADFQFNSGTLCYVTGWGHKQEGVSLTGA---AALREVEVPII 184

  Fly   183 SDEEC------TERHGGRTDPRYH-ICGGVDEGGKGQCSGDSGGPLIY---NGQ--QVGIVSWSI 235
            ....|      ........|.... ||.|..||||..|.|||||||:.   ||.  |.|:||:.:
Zfish   185 DQSSCQFMYQILSSDSSTVDILSDMICAGYKEGGKDSCQGDSGGPLVCPVGNGTWIQAGVVSFGL 249

  Fly   236 KPCTVAPYPGVYCKVSQYVDWIK 258
             .|.....||:|.:||.:...|:
Zfish   250 -GCAQKNRPGIYSRVSSFEKLIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 78/250 (31%)
Tryp_SPc 30..259 CDD:238113 78/252 (31%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 78/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.