DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and PROZ

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_016876301.1 Gene:PROZ / 8858 HGNCID:9460 Length:467 Species:Homo sapiens


Alignment Length:266 Identity:67/266 - (25%)
Similarity:108/266 - (40%) Gaps:58/266 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTL 81
            |.|..:.||.:..:           |:.|.|.:.:|...|||.||.::||:|.|.|:......|:
Human   242 VLTSEKRAPDLQDL-----------PWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITV 295

  Fly    82 SIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFA 146
            ...|   |.::..|.::.|..:..|..:| .....||:|||.:|.|.:..|..: ||..|...||
Human   296 KTYF---NRTSQDPLMIKITHVHVHMRYD-ADAGENDLSLLELEWPIQCPGAGL-PVCTPEKDFA 355

  Fly   147 ----VPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEEC--------TSR---HNGQTD 196
                :|::    .|:|.||..|.|  .:.::|....:.:...|||        |:|   ......
Human   356 EHLLIPRT----RGLLSGWARNGT--DLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVA 414

  Fly   197 PKYHICGGV---DEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            ..:.:.|.|   :..|....:|..|...:  |.|..:|              :..|||:|..|.|
Human   415 AMHWMDGSVVTREHRGSWFLTGVLGSQPV--GGQAHMV--------------LVTKVSRYSLWFK 463

  Fly   259 SNQIIS 264
              ||::
Human   464 --QIMN 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 59/245 (24%)
Tryp_SPc 30..260 CDD:238113 61/247 (25%)
PROZXP_016876301.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7840
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.