DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and TMPRSS5

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:260 Identity:84/260 - (32%)
Similarity:138/260 - (53%) Gaps:26/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGR 76
            :|.|..:..| |.|..||:|.|...:..::|:..|: :....|:||||:::..:|:|||||.:..
Human   201 VVSLRCSECG-ARPLASRIVGGQSVAPGRWPWQASV-ALGFRHTCGGSVLAPRWVVTAAHCMHSF 263

  Fly    77 PADTLS---IQFGVTNISAMGPNVVG-IKKIIQHEDFDPTRQNAN-DISLLMVEEPFEFDGVSVA 136
            ....||   :..|:.:.||:.|:... :::||.|..:  :.||.: |::||.::....|.. :|.
Human   264 RLARLSSWRVHAGLVSHSAVRPHQGALVERIIPHPLY--SAQNHDYDVALLRLQTALNFSD-TVG 325

  Fly   137 PVELPALAFAVPQSDAGVEGVLIGWG---LNDTYGSVQDTLQEVSLKIYSDEECTSR--HNGQTD 196
            .|.|||.....|:   |....:.|||   .:.||.|  |.||:..:.::|.:.|.|.  ::|...
Human   326 AVCLPAKEQHFPK---GSRCWVSGWGHTHPSHTYSS--DMLQDTVVPLFSTQLCNSSCVYSGALT 385

  Fly   197 PKYHICGGVDEGGKGQCSGDSGGPLIY----NGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            |:. :|.|..:|....|.|||||||:.    ..:.||:|||. :.|....:||||.||::::|||
Human   386 PRM-LCAGYLDGRADACQGDSGGPLVCPDGDTWRLVGVVSWG-RGCAEPNHPGVYAKVAEFLDWI 448

  Fly   258  257
            Human   449  448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 76/241 (32%)
Tryp_SPc 30..260 CDD:238113 77/242 (32%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:292133 4/12 (33%)
Tryp_SPc 217..448 CDD:214473 76/241 (32%)
Tryp_SPc 218..451 CDD:238113 77/242 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.