DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Tmprss5

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001346389.1 Gene:Tmprss5 / 80893 MGIID:1933407 Length:455 Species:Mus musculus


Alignment Length:261 Identity:88/261 - (33%)
Similarity:134/261 - (51%) Gaps:28/261 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGS-HSCGGSIISKHFVMTAAHCTNG 75
            ||.|..:..| |.|..||:|.|...:..::|:..|:..  || |:||.|:::.|:|:|||||...
Mouse   201 IVSLKCSECG-ARPLASRIVGGQAVASGRWPWQASVML--GSRHTCGASVLAPHWVVTAAHCMYS 262

  Fly    76 RPADTLS---IQFGVTNISAMGPNV-VGIKKIIQHEDFDPTRQNAN-DISLLMVEEPFEFDGVSV 135
            .....||   :..|:.:..|:..:. ..::|||.|..:  :.||.: |::||.:..|..|.. :|
Mouse   263 FRLSRLSSWRVHAGLVSHGAVRQHQGTMVEKIIPHPLY--SAQNHDYDVALLQLRTPINFSD-TV 324

  Fly   136 APVELPALAFAVPQSDAGVEGVLIGWGLND---TYGSVQDTLQEVSLKIYSDEECTS--RHNGQT 195
            ..|.|||.....|.   |.:..:.|||..|   |:.|  ||||:..:.:.|...|.|  .::|..
Mouse   325 GAVCLPAKEQHFPW---GSQCWVSGWGHTDPSHTHSS--DTLQDTMVPLLSTYLCNSSCMYSGAL 384

  Fly   196 DPKYHICGGVDEGGKGQCSGDSGGPLIY-NGQQ---VGIVSWSIKPCTVAPYPGVYCKVSQYVDW 256
            ..:. :|.|..:|....|.|||||||:. :|..   ||:|||. :.|.....||||.||::::||
Mouse   385 THRM-LCAGYLDGRADACQGDSGGPLVCPSGDTWHLVGVVSWG-RGCAEPNRPGVYAKVAEFLDW 447

  Fly   257 I 257
            |
Mouse   448 I 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 79/242 (33%)
Tryp_SPc 30..260 CDD:238113 80/243 (33%)
Tmprss5NP_001346389.1 SRCR_2 116..213 CDD:317845 5/12 (42%)
Tryp_SPc 217..448 CDD:214473 79/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.