DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Prss36

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:269 Identity:88/269 - (32%)
Similarity:130/269 - (48%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHC--TNG--RPADTL 81
            |:..|| ||:|.|:|:....:|:.|||.. .|.|.||||:|:..:|::||||  |||  .|||.|
Mouse    40 GRPEPS-SRIVGGSDAHPGTWPWQVSLHQ-GGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEL 102

  Fly    82 SIQFGVTNISAMGP----NVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPA 142
            |:..||.  |..||    ::..:..|:..:::......| |::||.:..|.:. |.||.||.||.
Mouse   103 SVLLGVH--SQDGPLEGAHMRSVATILIPDNYSTVELGA-DLALLRLASPAKL-GPSVRPVCLPR 163

  Fly   143 LA--FAVPQSDAGVEGVLIGWGLNDTYGSVQD--------TLQEVSLKIYSDEECTSRHN--GQT 195
            .:  ||     .|......||      |.||:        .||||.|::..:..|...::  |..
Mouse   164 ASHLFA-----HGTACWATGW------GDVQEAVPLPLPWVLQEVELRLLGEAACQCLYSRPGPF 217

  Fly   196 DPKYH-----ICGGVDEGGKGQCSGDSGGPLI-YNGQQ---VGIVSWSIKPCTVAPYPGVYCKVS 251
            :..:.     :|.|...|.:..|.|||||||: .:|.:   .||.|:.. .|.....|||:..|:
Mouse   218 NLTFQLLPGMLCAGYPAGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGF-GCGRRNRPGVFTAVA 281

  Fly   252 QYVDWIKSN 260
            .|..||:.:
Mouse   282 PYESWIREH 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 82/256 (32%)
Tryp_SPc 30..260 CDD:238113 83/258 (32%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 83/258 (32%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.