DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Prss8

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:277 Identity:79/277 - (28%)
Similarity:131/277 - (47%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLSLIVILAVTTVGQAAPSIS---------RVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISK 63
            :::::::|.:...|..|....         |:..|..:...::|:.||: :|||:|.||||::|.
Mouse    14 AVTILLLLGLLQSGIRADGTEASCGAVIQPRITGGGSAKPGQWPWQVSI-TYDGNHVCGGSLVSN 77

  Fly    64 HFVMTAAHC-TNGRPADTLSIQFGVTNISAMGPNVV--GIKKIIQHEDFDPTRQNAN--DISLLM 123
            .:|::|||| ......:...::.|...:.:...:.|  .:.:||.|..:   |:..:  ||:|:.
Mouse    78 KWVVSAAHCFPREHSREAYEVKLGAHQLDSYSNDTVVHTVAQIITHSSY---REEGSQGDIALIR 139

  Fly   124 VEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQD--TLQEVSLKIYSDEE 186
            :..|..|... :.|:.|||...:.|.   |:...:.|||......|:|.  .||::.:.:.|.|.
Mouse   140 LSSPVTFSRY-IRPICLPAANASFPN---GLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRET 200

  Fly   187 CTSRHNGQTDPKY-H------ICGGVDEGGKGQCSGDSGGPLIYNGQQV----GIVSWSIKPCTV 240
            |:..:|....|:. |      :|.|..:|||..|.|||||||....:.:    |||||. ..|..
Mouse   201 CSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVSWG-DACGA 264

  Fly   241 APYPGVYCKVSQYVDWI 257
            ...||||...|.|..||
Mouse   265 PNRPGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 74/245 (30%)
Tryp_SPc 30..260 CDD:238113 75/246 (30%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.