DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Prss44

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:247 Identity:86/247 - (34%)
Similarity:126/247 - (51%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISA 92
            :|:|.|..:...|:|:.|||:.:. .|.||||:|||.:|:|||||..|..  ..::..|..::.:
Mouse   110 ARIVGGRPAPARKWPWQVSLQVHK-QHICGGSLISKWWVITAAHCVYGHL--DYAVFMGDADLWS 171

  Fly    93 MGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGV 157
            ..|..:.::.||.|:||...|...:||:|:::..|..: .|::.||.:|..:|.|   ..|....
Mouse   172 KRPVRIPVQDIIVHQDFSMMRTVVHDIALVLLAFPVNY-SVNIQPVCIPEKSFLV---QPGTLCW 232

  Fly   158 LIGWGLNDTYGSVQDTLQEVSLKIYSDEECTS-------------RHNGQTDPKYHICGGVDEGG 209
            :.|||.....|.....|||:.|.|...|:|..             :..|       :||..::||
Mouse   233 VTGWGKVLEQGRSSRILQEIELNIIRHEKCNQILKDIMGNIFTLVQEGG-------VCGYNEKGG 290

  Fly   210 KGQCSGDSGGPLI--YNGQ--QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            .. |.|||||||:  :|..  |||||||.: .|....|||||.:||.|.|||
Mouse   291 DA-CQGDSGGPLVCEFNKTWVQVGIVSWGL-GCGRIGYPGVYTEVSYYRDWI 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 84/244 (34%)
Tryp_SPc 30..260 CDD:238113 85/245 (35%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 111..340 CDD:214473 84/244 (34%)
Tryp_SPc 112..340 CDD:238113 83/243 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.