DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and TPSAB1

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:283 Identity:89/283 - (31%)
Similarity:129/283 - (45%) Gaps:49/283 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLSLIVILAVTTVGQAAP----SISRV--VNGTDSSVLKYPFVVSLRSYD--GSHSCGGSIISK 63
            |:|.|:.:..:.:...|||    ::.||  |.|.::...|:|:.||||.:.  ..|.||||:|..
Human     2 LNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHP 66

  Fly    64 HFVMTAAHCTNGRPAD--TLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEE 126
            .:|:|||||......|  .|.:|....::... ..::.:.:||.|..| .|.|...||:||.:||
Human    67 QWVLTAAHCVGPDVKDLAALRVQLREQHLYYQ-DQLLPVSRIIVHPQF-YTAQIGADIALLELEE 129

  Fly   127 PFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWG--LNDTYGSVQDTLQEVSLKIYSDEECTS 189
            |..... .|..|.||..:...|   .|:...:.|||  .||........|::|.:.|..:..|  
Human   130 PVNVSS-HVHTVTLPPASETFP---PGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHIC-- 188

  Fly   190 RHNGQTDPKYH----------------ICGGVDEGGKGQCSGDSGGPLI--YNGQ--QVGIVSWS 234
                  |.|||                :|.|  ...:..|.|||||||:  .||.  |.|:|||.
Human   189 ------DAKYHLGAYTGDDVRIVRDDMLCAG--NTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWG 245

  Fly   235 IKPCTVAPYPGVYCKVSQYVDWI 257
             :.|.....||:|.:|:.|:|||
Human   246 -EGCAQPNRPGIYTRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 81/255 (32%)
Tryp_SPc 30..260 CDD:238113 82/256 (32%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 81/254 (32%)
Tryp_SPc 31..267 CDD:214473 79/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.