DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Prss41

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:298 Identity:84/298 - (28%)
Similarity:135/298 - (45%) Gaps:70/298 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DLSLSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAA 70
            ||..:.|.:|:: ..|:...:.||:|.|.:|...::|:..||| ...||.||||::|:.:|:|||
Mouse    61 DLKSTDIKLLSM-PCGRRNDTRSRIVGGIESMQGRWPWQASLR-LKKSHRCGGSLLSRRWVLTAA 123

  Fly    71 HC----------------TNGRPA----DTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQN 115
            ||                ...:|:    ...|.::.|.:|            |:..||    :..
Mouse   124 HCFRKYLDPEKWTVQLGQLTSKPSYWNRKAYSGRYRVKDI------------IVNSED----KLK 172

  Fly   116 ANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDT------- 173
            ::|::||.:.....:: ..:.||.:....|.   |.......:.|||:      :|:.       
Mouse   173 SHDLALLRLASSVTYN-KDIQPVCVQPSTFT---SQHQPRCWVTGWGV------LQEDLKPLPPP 227

  Fly   174 --LQEVSLKIYSDEECT------SRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYN----GQ 226
              |:||.:.|.::..|.      |.|:..|  |...|.|.::|....|||||||||:.|    ..
Mouse   228 YHLREVQVSILNNSRCQELFEIFSLHHLIT--KDVFCAGAEDGSADTCSGDSGGPLVCNMDGLWY 290

  Fly   227 QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSNQIIS 264
            |:|||||.| .|.....||:|..||.|.:||::..|::
Mouse   291 QIGIVSWGI-GCGRPNLPGIYTNVSHYYNWIETMMILN 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 75/266 (28%)
Tryp_SPc 30..260 CDD:238113 76/268 (28%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 75/266 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.