DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Klk13

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001034131.2 Gene:Klk13 / 626834 MGIID:3615275 Length:276 Species:Mus musculus


Alignment Length:275 Identity:87/275 - (31%)
Similarity:129/275 - (46%) Gaps:45/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIVILAVTTVGQAAPSISR----VVNGTD--SSVL---------KYPFVVSLRSYDGSHSCGGSI 60
            |:..:|..|:. .:..|||    ::|||:  |..|         ..|:..:| ...|...|||.:
Mouse     4 LVATIACLTLA-LSEGISRDYPKILNGTNGTSGFLPGGYTCLPHSQPWQAAL-LIRGRLLCGGVL 66

  Fly    61 ISKHFVMTAAHCTNGRPADTLSIQFGVTNISAM--GPNVVGIKKIIQHEDFDPTRQNAN---DIS 120
            :...:|:|||||..    |..::..|...:..:  |...:.:.:.|.|.::..|..:.|   ||.
Mouse    67 VHPKWVLTAAHCRK----DGYTVHLGKHALGRVENGEQAMEVVRSIPHPEYQVTPTHLNHDHDIM 127

  Fly   121 LLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGV---LIGWGLNDTYGSVQ----DTLQEVS 178
            ||.::.|.:... .|..::|.|       .|....|.   :.|||   |..|.|    .|||..:
Mouse   128 LLELKSPVQLSS-HVRTLKLSA-------DDCLPTGTCCRVSGWG---TTTSPQVNYPKTLQCAN 181

  Fly   179 LKIYSDEECTSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPY 243
            :::.|||||...:.|:..... :|.|..||||..|.||||||||.||:..||:||...||.....
Mouse   182 IELRSDEECRQVYPGKITANM-LCAGTKEGGKDSCEGDSGGPLICNGKLYGIISWGDFPCGQPNR 245

  Fly   244 PGVYCKVSQYVDWIK 258
            ||||.:||:|:.||:
Mouse   246 PGVYTRVSKYLRWIR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 80/254 (31%)
Tryp_SPc 30..260 CDD:238113 81/252 (32%)
Klk13NP_001034131.2 Tryp_SPc 39..262 CDD:238113 76/239 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.