DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG17242

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:253 Identity:64/253 - (25%)
Similarity:107/253 - (42%) Gaps:31/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPA 78
            ||.:.::.|.|.....:      .:.:.|:..|::..| .|.|||.|.|:..::|.|.|......
  Fly     6 ILLLVSIAQIAADFKSI------GIEQAPWQASVQIND-KHHCGGVIYSEDIILTIAECVRKARL 63

  Fly    79 DTLSIQFGVTNISAMGPNVVGIKKI-IQHEDFDPTRQNANDISLLMVEEPFEFDG----VSVAPV 138
            :.:|::.|....:| |..|:.::|: :|.....|     :|:::|.:..|...||    :.:|.:
  Fly    64 EFISVRVGSAQENA-GGTVLKVEKMRLQVLGLRP-----SDVAILQLRSPLYLDGGIRAIPLATI 122

  Fly   139 ELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSR--HNGQTDPKYHI 201
            .|      ||.::|.|.    |||.........:.|..|.:||.....|.:.  ..|:......|
  Fly   123 PL------VPGTNASVS----GWGQLSAMNPSSEVLLRVDVKIQDQLMCATNLALKGRLMSVGEI 177

  Fly   202 CGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKS 259
            |..........|.|..||||:.|.:..||:||. ..|.|.....||..::.:..||:|
  Fly   178 CAAPAGEIPYACQGFVGGPLVANNRLYGILSWQ-SACDVLNKSSVYANIAMFKVWIES 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 57/234 (24%)
Tryp_SPc 30..260 CDD:238113 60/237 (25%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 60/229 (26%)
Tryp_SPc 24..232 CDD:214473 57/225 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.