DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG34436

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:299 Identity:59/299 - (19%)
Similarity:115/299 - (38%) Gaps:83/299 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSNQDLSLSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHF 65
            ||:||.         :...:.|....:||:.|   ..:...|::..:..  .:.:|.|::|.|:|
  Fly    13 MLANQG---------SAQLLDQNCAEVSRLSN---DIIFSRPWMALVLL--PNKTCSGALIHKYF 63

  Fly    66 VMTAAHCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNA------------ND 118
            |:|:|.|...:  :...::.|..:|..        :.|:.:...|...|:|            :|
  Fly    64 VITSASCVFNQ--ERAIVRLGQLSIKQ--------EHIVSYSSDDYHVQSAYIHRFYEKSNFEHD 118

  Fly   119 ISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGV----LIGWGLNDTYGSVQDTLQEVSL 179
            |:||.::....:. ..:.|:     ...:.:||...:..    ...||:::.|  :....:...:
  Fly   119 IALLELQNDVLYK-AHIRPI-----CLWLDKSDIDTQMFKRYETFRWGIDEKY--ILPAAKTSKI 175

  Fly   180 KIYSDEECTSRHNGQTDPK-YHICGGVDEGGKGQCSGDSGGPL-------------IYNGQQVGI 230
            |..|..:|.:..  :..|: .|||.|..  .|.:|. ::|.||             ::..|..| 
  Fly   176 KHISQVKCENAF--KLYPQNSHICAGYK--NKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQSYG- 234

  Fly   231 VSWSIKPCTVAPYPGVYCKVSQYVDWIKS-----NQIIS 264
               ..:.|       :|..|::|:|||..     |.|:|
  Fly   235 ---ESRTC-------LYTDVTKYIDWIMGVIQNVNVIVS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 48/257 (19%)
Tryp_SPc 30..260 CDD:238113 49/264 (19%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 47/247 (19%)
Tryp_SPc 40..251 CDD:214473 46/246 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455951
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.