DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:263 Identity:79/263 - (30%)
Similarity:127/263 - (48%) Gaps:34/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GQAAPSIS-RVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQ 84
            |:..|::: |:|.|.:::...:|::|||:...| |.||||:|:..:|:|||||...:...::.:.
Zfish    26 GRPNPTLNPRIVGGVNATHGAWPWMVSLQGRYG-HFCGGSLINNQWVLTAAHCIVDQTPSSIIVY 89

  Fly    85 FG-----VTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALA 144
            .|     |.:::::...   |:.||.|..:....:: |||:||.:....::... :.|:   .||
Zfish    90 LGKWRSYVADVNSISRT---IRHIIPHPSYSNITKD-NDIALLQLTSTVQYTDY-IKPI---CLA 146

  Fly   145 FAVPQSDAGVEGVLIGWGLNDTYG----------SV----QDTLQEVSLKIYSDEECTSRHNGQT 195
            ........|....:.|||.....|          ||    ...|||..||:||:.:|.:..:|:.
Zfish   147 DENSNFPRGTNSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYSNADCNNICHGRI 211

  Fly   196 DPKYHICGGVDEGGKGQCSGDSGGPLIYNGQ---QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            .|.. ||.|...|||...||||||||:....   |.|::|... .|.....|.|:.:||:|..||
Zfish   212 TPNM-ICAGTRPGGKATFSGDSGGPLMTKCSVWVQAGVLSHGY-GCAQPNLPEVFIRVSEYKQWI 274

  Fly   258 KSN 260
            ..|
Zfish   275 TGN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 74/249 (30%)
Tryp_SPc 30..260 CDD:238113 75/251 (30%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 73/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.