DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Klk4

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:257 Identity:79/257 - (30%)
Similarity:125/257 - (48%) Gaps:32/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VILAVTTVGQAAPSI-SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGR 76
            :||.||  |.:|.|: ||::.|.|.|....|:..:|.|.|| ..|.|.::...:|::||||..  
Mouse    16 LILEVT--GASASSVSSRIIQGQDCSPHSQPWQAALFSEDG-FFCSGVLVHPQWVLSAAHCLQ-- 75

  Fly    77 PADTLSIQFGVTNISAM---GPNVVGIKKIIQHEDF-DPTRQNANDISLLMVEEP-FEFDGVSVA 136
              ::..:..|:.|:...   |..::.....|||.:| ||:  .|||:.|:.:.|. .|.:.:...
Mouse    76 --ESYIVGLGLHNLKGSQEPGSRMLEAHLSIQHPNFNDPS--FANDLMLIKLNESVIESNTIRSI 136

  Fly   137 PVELPALAFAVPQSDAGVEGVLIGWG-LNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYH 200
            ||       |......|...::.||| |.:  |.:...||.|:|.:.|:|.|...:    ||.||
Mouse   137 PV-------ATQCPTPGDTCLVSGWGQLKN--GKLPSLLQCVNLSVASEETCRLLY----DPVYH 188

  Fly   201 I---CGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKS 259
            :   |.|..:..|..|:||||||::.|....|:||.....|.....|.||..:.::.:||::
Mouse   189 LSMFCAGGGQDQKDSCNGDSGGPIVCNRSLQGLVSMGQGKCGQPGIPSVYTNLCKFTNWIQT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 69/236 (29%)
Tryp_SPc 30..260 CDD:238113 70/239 (29%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.