DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and AZU1

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:262 Identity:71/262 - (27%)
Similarity:121/262 - (46%) Gaps:42/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCT 73
            |:|:..|..::...::|.:. :|.|..:...::||:.|::: .|.|.|||::|...||||||.|.
Human     7 LALLAGLLASSRAGSSPLLD-IVGGRKARPRQFPFLASIQN-QGRHFCGGALIHARFVMTAASCF 69

  Fly    74 NGRPADTLSIQFG-------------VTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVE 125
            ..:.....::..|             ..:||:|..|           .:|| :||.||:.||.::
Human    70 QSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSEN-----------GYDP-QQNLNDLMLLQLD 122

  Fly   126 EPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSR 190
            ....... ||..:.||.....|   :||....:.|||...:.|.:....:.|::.:..:::|  |
Human   123 REANLTS-SVTILPLPLQNATV---EAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQC--R 181

  Fly   191 HNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVD 255
            .|       ::|.||.....|.|:||.|.||:..|...|:.|:|:.||  ...|..:.:|:.:.|
Human   182 PN-------NVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPC--GRGPDFFTRVALFRD 237

  Fly   256 WI 257
            ||
Human   238 WI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 65/240 (27%)
Tryp_SPc 30..260 CDD:238113 67/241 (28%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 67/241 (28%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 13/24 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.