DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and PRTN3

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:257 Identity:81/257 - (31%)
Similarity:118/257 - (45%) Gaps:34/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSL--RSYDGSHSCGGSIISKHFVMTAAHCTNG 75
            |:||:...|  |...:.:|.|.::.....|::.||  |...|||.|||::|...||:|||||...
Human    13 VLLALLLSG--AARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRD 75

  Fly    76 RPADTLSIQFGVTNISAMGPNVVGIKKIIQH--------EDFDPTRQNANDISLLMVEEPFEFDG 132
            .|...:::..|..|:....|..       ||        .::| .....||:.|:.:..|... .
Human    76 IPQRLVNVVLGAHNVRTQEPTQ-------QHFSVAQVFLNNYD-AENKLNDVLLIQLSSPANL-S 131

  Fly   133 VSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDP 197
            .|||.|:||.....||.   |.:.:.:|||....:......|||:::.:.: ..|.. ||     
Human   132 ASVATVQLPQQDQPVPH---GTQCLAMGWGRVGAHDPPAQVLQELNVTVVT-FFCRP-HN----- 186

  Fly   198 KYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKS 259
               ||..|.....|.|.||||||||.:|...||.|:.|..|....:|..:.:|:.|||||:|
Human   187 ---ICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 73/237 (31%)
Tryp_SPc 30..260 CDD:238113 76/240 (32%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 76/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.