DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Klk11

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:265 Identity:83/265 - (31%)
Similarity:122/265 - (46%) Gaps:41/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLIVILAVT-TVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSH-SCGGSIISKHFVMTAAH 71
            |.||.:..|| .||    ..:|::.|.:......|:.|:|  :..:. .||.::|:..:::||||
Mouse    30 LRLIALALVTGHVG----GETRIIKGYECRPHSQPWQVAL--FQKTRLLCGATLIAPKWLLTAAH 88

  Fly    72 CTNGRPADTLSIQFGVTNISAMGPNVVGIK------KIIQHEDFD---PTRQNANDISLLMVEEP 127
            |....    ..|..|..|:.    ...|.:      :...|.||:   |.:.:.|||.|:.:..|
Mouse    89 CRKPH----YVILLGEHNLE----KTDGCEQRRMATESFPHPDFNNSLPNKDHRNDIMLVKMSSP 145

  Fly   128 FEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQ----DTLQEVSLKIYSDEECT 188
            ..|.. :|.|:.|.....|     ||...::.|||   |..|.|    .:|:..::.|...:||.
Mouse   146 VFFTR-AVQPLTLSPHCVA-----AGTSCLISGWG---TTSSPQLRLPHSLRCANVSIIEHKECE 201

  Fly   189 SRHNGQ-TDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQ 252
            ..:.|. ||..  :|..|.:.||..|.|||||||:.||...||:||...||.|...||||.||.:
Mouse   202 KAYPGNITDTM--LCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCK 264

  Fly   253 YVDWI 257
            |.:||
Mouse   265 YFNWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 74/242 (31%)
Tryp_SPc 30..260 CDD:238113 75/243 (31%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 74/242 (31%)
Tryp_SPc 48..272 CDD:238113 75/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.