DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and PRSS3

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:245 Identity:87/245 - (35%)
Similarity:127/245 - (51%) Gaps:22/245 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VGQAAP--SISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLS 82
            :|.|.|  ...::|.|........|:.|||.|  |||.||||:||:.:|::||||...|    :.
Human    98 LGVAVPFDDDDKIVGGYTCEENSLPYQVSLNS--GSHFCGGSLISEQWVVSAAHCYKTR----IQ 156

  Fly    83 IQFGVTNISAMGPN--VVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAF 145
            ::.|..||..:..|  .:...|||:|..::....: |||.|:.:..|...: ..|:.:.||....
Human   157 VRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLD-NDIMLIKLSSPAVIN-ARVSTISLPTTPP 219

  Fly   146 AVPQSDAGVEGVLIGWGLNDTYGS-VQDTLQEVSLKIYSDEECTSRHNGQ-TDPKYHICGGVDEG 208
            |     ||.|.::.|||...::|: ..|.|:.:...:.:..||.:.:.|: |:..:  |.|..||
Human   220 A-----AGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMF--CVGFLEG 277

  Fly   209 GKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            ||..|..|||||::.|||..|:|||. ..|.....||||.||..||||||
Human   278 GKDSCQRDSGGPVVCNGQLQGVVSWG-HGCAWKNRPGVYTKVYNYVDWIK 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 81/231 (35%)
Tryp_SPc 30..260 CDD:238113 84/233 (36%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 81/231 (35%)
Tryp_SPc 110..328 CDD:238113 84/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.