DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and PRSS2

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:266 Identity:94/266 - (35%)
Similarity:136/266 - (51%) Gaps:28/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLIVILAVTTVGQAAP--SISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAH 71
            ::|::||.......|||  ...::|.|........|:.|||.|  |.|.||||:||:.:|::|.|
Human     1 MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNS--GYHFCGGSLISEQWVVSAGH 63

  Fly    72 C--------TNGRPAD--TLSIQFGVTNISAMGPN--VVGIKKIIQHEDFDPTRQNANDISLLMV 124
            |        .:||..:  .:.::.|..||..:..|  .:...|||:|..:: :|...|||.|:.:
Human    64 CYKSAINSKLSGRGCEYHRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYN-SRTLDNDILLIKL 127

  Fly   125 EEPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGS-VQDTLQEVSLKIYSDEECT 188
            ..|...:. .|:.:.||.   |.|.  ||.|.::.|||...:.|: ..|.||.:...:.|..||.
Human   128 SSPAVINS-RVSAISLPT---APPA--AGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECE 186

  Fly   189 SRHNGQ-TDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQ 252
            :.:.|: |:..:  |.|..||||..|.||||||::.||:..|||||.. .|.....||||.||..
Human   187 ASYPGKITNNMF--CVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGY-GCAQKNRPGVYTKVYN 248

  Fly   253 YVDWIK 258
            ||||||
Human   249 YVDWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 85/241 (35%)
Tryp_SPc 30..260 CDD:238113 88/243 (36%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 85/241 (35%)
Tryp_SPc 24..256 CDD:238113 88/243 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.