DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and KLK15

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:266 Identity:88/266 - (33%)
Similarity:130/266 - (48%) Gaps:32/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYD-GSHSCGGSIISKHFVMTAA 70
            |.|:|..:||.|    ||....:::.|.:.:....|:.|:|  |: |..:||.|:||.|:|::||
Human     3 LLLTLSFLLAST----AAQDGDKLLEGDECAPHSQPWQVAL--YERGRFNCGASLISPHWVLSAA 61

  Fly    71 HCTNGRPADTLSIQFGVTNISAM-GPNVV-GIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGV 133
            ||    .:..:.::.|..|:... ||..: ...::|.|..:: .|.:.|||.||.:.:|...: .
Human    62 HC----QSRFMRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYE-ARSHRNDIMLLRLVQPARLN-P 120

  Fly   134 SVAPVELPALAFAVPQSDAGVEGVLIGWGL---ND--TYG------SVQDTLQEVSLKIYSDEEC 187
            .|.|..||...     ...|...|:.||||   |:  |.|      |:.|||...::.|.||..|
Human   121 QVRPAVLPTRC-----PHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSC 180

  Fly   188 TSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQ 252
            ...:.|:. ....:|.|.:..|...|.|||||||:..|...|||||...||.....||||.||..
Human   181 DKSYPGRL-TNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCH 244

  Fly   253 YVDWIK 258
            |::||:
Human   245 YLEWIR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 78/241 (32%)
Tryp_SPc 30..260 CDD:238113 80/243 (33%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 78/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.