DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and prss60.2

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:271 Identity:92/271 - (33%)
Similarity:131/271 - (48%) Gaps:31/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLSLIV-----ILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRS--YDGSHSCGGSIISKHF 65
            :|:|::     :..:...|| ||..||:|.|.::....:|:.|||:|  | |.|.||||:||..:
Zfish     8 TLTLLICVKGSLSQLNVCGQ-APLNSRIVGGVNAPEGSWPWQVSLQSPRY-GGHFCGGSLISSEW 70

  Fly    66 VMTAAHCTNGRPADTLSIQFGVTNISAMGPNV----VGIKKIIQHEDFDPTRQNANDISLLMVEE 126
            |:|||||..|....:|.:..|  ..:..|.|.    ..:.|||.|..:: :..|.|||:||.:..
Zfish    71 VLTAAHCLPGVSESSLVVYLG--RRTQQGVNTHETSRNVAKIIVHSSYN-SNTNDNDIALLRLSS 132

  Fly   127 PFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQ----DTLQEVSLKIYSDEEC 187
            ...|:.. :.||   .||.......||....:.|||  |....|.    ..|||..:.:.:::.|
Zfish   133 AVTFNDY-IRPV---CLAAQNSVYSAGTSSWITGWG--DVQAGVNLPAPGILQETMIPVVANDRC 191

  Fly   188 TSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYN----GQQVGIVSWSIKPCTVAPYPGVYC 248
            .::....|.....||.|:.:|||..|.||||||::..    ..|.||.||.. .|.....||||.
Zfish   192 NAQLGSGTVTNNMICAGLAKGGKDTCQGDSGGPMVTRLCTVWIQAGITSWGY-GCADPNSPGVYT 255

  Fly   249 KVSQYVDWIKS 259
            :||||..||.|
Zfish   256 RVSQYQSWISS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 82/241 (34%)
Tryp_SPc 30..260 CDD:238113 84/244 (34%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 82/241 (34%)
Tryp_SPc 34..267 CDD:238113 84/244 (34%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.