DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Prss44

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:247 Identity:84/247 - (34%)
Similarity:125/247 - (50%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISA 92
            :|:|.|..:.:.|:|:.|||:.:. .|.||||:|||.:|||||||..|.....:|:  |..::.:
  Rat   111 ARIVGGKPAPIRKWPWQVSLQVHK-QHICGGSLISKWWVMTAAHCVYGHLDYVVSM--GEADLWS 172

  Fly    93 MGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGV 157
            .....:.::.||.|:|:...|...:||:|:::..|..: .|::.||.:|..:|.|   ..|....
  Rat   173 SMSVKIPVQDIIVHQDYSVMRTIVHDIALVLLAFPVNY-SVNIQPVCIPEKSFLV---QPGTLCW 233

  Fly   158 LIGWGLNDTYGSVQDTLQEVSLKIYSDEECTS-------------RHNGQTDPKYHICGGVDEGG 209
            :.|||.....|.....|:||.|.|...|.|..             :..|       :||...:||
  Rat   234 VTGWGKTIERGRSSRVLREVDLSIIRHERCNQILKDITGRIFTLVQEGG-------VCGYNKKGG 291

  Fly   210 KGQCSGDSGGPLI--YNGQ--QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            .. |.||||||::  :|..  |||||||.: .|....|||:|.:||.|.|||
  Rat   292 DA-CQGDSGGPMVCEFNKTWVQVGIVSWGL-GCGRIGYPGIYTEVSYYRDWI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 82/244 (34%)
Tryp_SPc 30..260 CDD:238113 83/245 (34%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 82/244 (34%)
Tryp_SPc 113..341 CDD:238113 81/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.