DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Prss53

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:249 Identity:65/249 - (26%)
Similarity:113/249 - (45%) Gaps:33/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AAPSISRVVNGTDSSVL-KYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPA-DTLSIQF 85
            |..|:|.  .|..:..| ::|:...|: :.|..:|||:::|:..|:|||||..||.. :..|:..
  Rat   334 ACGSLSS--GGPQAGALSQWPWDARLK-HHGKLACGGALVSEVVVLTAAHCFIGRQTLEEWSVGL 395

  Fly    86 GVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQS 150
            |.      ||...|:|::|.|..:... :..:|::.|::.:|... |..:.|:.||.....:|..
  Rat   396 GA------GPEEWGLKQLILHGAYTHP-EGGHDVAFLLLAQPVTL-GPGLRPLCLPYADHRLPDG 452

  Fly   151 DAG-VEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRH--NGQTDPKY---HICGGVDEGG 209
            :.| |.|:....|:|..:        .|.:.:.....|:.:|  :|.|....   .||..| .|.
  Rat   453 EHGWVLGLTREAGINHPH--------TVPVTVLGPMACSRQHAASGSTGVPILPGMICTTV-VGE 508

  Fly   210 KGQCSGDSGGPLIYNGQ----QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKS 259
            ...|.|.||.||::..:    ..|:.|:. ..|..:..|.|:..:|.|.||:.:
  Rat   509 PPHCEGLSGAPLVHEIRGTWFLAGLHSFG-DTCQGSAKPAVFAALSAYEDWVSN 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 61/239 (26%)
Tryp_SPc 30..260 CDD:238113 62/242 (26%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113
Tryp_SPc 341..561 CDD:238113 62/238 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.