DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Prss36

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:270 Identity:90/270 - (33%)
Similarity:131/270 - (48%) Gaps:49/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHC--TNG--RPADTL 81
            |:..|| ||:|.|:|:....:|:.|||. :.|.|.||||:|:..:|::||||  |||  .|||..
  Rat    51 GRPEPS-SRIVGGSDAHPGTWPWQVSLH-HGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEW 113

  Fly    82 SIQFGVTNISAMGP----NVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPA 142
            |:..||.  |..||    ::..:..|:..:::......| |::||.:..|.:. |.||.||.||.
  Rat   114 SVLLGVH--SQDGPLEGAHMRSVATILVPDNYSRVELGA-DLALLRLASPAKL-GPSVKPVCLPR 174

  Fly   143 LA--FAVPQSDAGVEGVLIGWGLNDTYGSVQDT--------LQEVSLKIYSDEECTSRHNG---- 193
            .:  ||     .|......||      |.||::        ||||.||:..:..|...::.    
  Rat   175 ASHLFA-----HGTACWATGW------GDVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPF 228

  Fly   194 ----QTDPKYHICGGVDEGGKGQCSGDSGGPLI-YNGQQ---VGIVSWSIKPCTVAPYPGVYCKV 250
                |..|.. :|.|..||.:..|.|||||||: .:|.:   .||.|:.. .|.....|||:..|
  Rat   229 NLTLQLLPGM-LCAGYPEGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGF-GCGRRNRPGVFTAV 291

  Fly   251 SQYVDWIKSN 260
            :.|..||:.:
  Rat   292 AHYESWIREH 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 84/257 (33%)
Tryp_SPc 30..260 CDD:238113 85/259 (33%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 85/259 (33%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.