DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and prss27

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:252 Identity:87/252 - (34%)
Similarity:125/252 - (49%) Gaps:30/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHC-TNGRPADTLSIQFGVTNIS 91
            ||::.|..:...::|:.||.|: :|.|.|||::|||.:|::|||| .:...|.:::...|...|.
 Frog    32 SRIMGGQSAQEGQWPWQVSFRN-NGGHFCGGTLISKQYVISAAHCFPSSSSASSVTAVLGAYMID 95

  Fly    92 AMGPNVVGIKKIIQHEDFDPTRQN---ANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDAG 153
            ....|.|.|.  :|.....|:..|   :.||||:.:..|..|... :.||.|||.....|   .|
 Frog    96 QPDGNQVAIP--VQSATNYPSYVNEGDSGDISLVQLASPVTFTNY-ILPVCLPADTVTFP---TG 154

  Fly   154 VEGVLIGWG--LNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKY-------H---ICGGVD 206
            ::..:.|||  .:|.......|||||::.:....||.:.:  ||...|       |   ||.|..
 Frog   155 LQCWVTGWGNIASDVSLVSPMTLQEVAVPLIDANECNALY--QTPNSYGTSSISVHSDMICAGFI 217

  Fly   207 EGGKGQCSGDSGGPLI--YNGQ--QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKS 259
            .|||..|.|||||||:  .:||  ..|:||:. :.|..|..||||..:..|.|||.|
 Frog   218 NGGKDSCQGDSGGPLVCSSSGQWFLAGVVSFG-EGCGQAYRPGVYTLMPSYTDWIVS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 83/247 (34%)
Tryp_SPc 30..260 CDD:238113 85/250 (34%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113 82/246 (33%)
Tryp_SPc 420..659 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.