DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and st14

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_012821897.2 Gene:st14 / 448647 XenbaseID:XB-GENE-1008784 Length:845 Species:Xenopus tropicalis


Alignment Length:252 Identity:77/252 - (30%)
Similarity:122/252 - (48%) Gaps:35/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNI-- 90
            ||:|.|.::...::|:.|||......|:||.|::|...:::||||..    |..|:::...::  
 Frog   603 SRIVGGVNADTGEFPWQVSLHVKGNKHTCGASLVSPTMLISAAHCFQ----DDQSMRYSDASLWT 663

  Fly    91 SAMG---------PNVV--GIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALA 144
            :.:|         .:||  .||:|:.|..|:....: ||||:|.:|:|.::... :.|:.:|...
 Frog   664 AYLGLHDQAQLNSKDVVERKIKRIMAHIGFNDNTYD-NDISVLELEKPVDYTDF-IQPICIPEST 726

  Fly   145 FAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVDEGG 209
            ...|   .|....:.|||.....|.....||:..::|.:..||....:||..|:. :|.|...||
 Frog   727 HDFP---VGKPIWVTGWGALKEGGGAAVILQKAEIRIINQTECNKLLDGQLTPRM-LCAGFVSGG 787

  Fly   210 KGQCSGDSGGPL--------IYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            ...|.|||||||        :|   ..|||||. :.|.....||||.:|:...|||:
 Frog   788 IDACQGDSGGPLSSVELNNKVY---LAGIVSWG-EGCARRNKPGVYTRVAMMRDWIR 840

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 74/248 (30%)
Tryp_SPc 30..260 CDD:238113 75/250 (30%)
st14XP_012821897.2 SEA 76..167 CDD:396113
CUB 216..320 CDD:238001
CUB 328..432 CDD:238001
LDLa 442..474 CDD:238060
LDLa 476..511 CDD:238060
LDLa 513..547 CDD:238060
LDLa 554..587 CDD:197566
Tryp_SPc 604..839 CDD:214473 74/248 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.