DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and KLK14

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:260 Identity:81/260 - (31%)
Similarity:135/260 - (51%) Gaps:25/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSL-----RSYDGSHSCGGSIISKHFV 66
            |.|:.:.:||: .:.|:....::::.|...:....|:..:|     |.:    .|||:::|..:|
Human     3 LLLTALQVLAI-AMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRF----LCGGALLSGQWV 62

  Fly    67 MTAAHCTNGRPADTLSIQFGVTNIS--AMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFE 129
            :|||||  |||  .|.:..|..|:.  .....|:.:.:.:.|.::: :|.:.||:.||.:::|..
Human    63 ITAAHC--GRP--ILQVALGKHNLRRWEATQQVLRVVRQVTHPNYN-SRTHDNDLMLLQLQQPAR 122

  Fly   130 FDGVSVAPVELPALAFAVPQSDAGVEGVLIGWG-LNDTYGSVQDTLQEVSLKIYSDEECTSRHNG 193
            . |.:|.|:|: ..|.|.|.:...|.    ||| ::........:||.|::.|..||.|...:..
Human   123 I-GRAVRPIEV-TQACASPGTSCRVS----GWGTISSPIARYPASLQCVNINISPDEVCQKAYPR 181

  Fly   194 QTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            ...|.. :|.||.:|||..|.|||||||:..||..|:|||.::.|.:..|||||..:.:|..||:
Human   182 TITPGM-VCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIE 245

  Fly   259  258
            Human   246  245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 74/235 (31%)
Tryp_SPc 30..260 CDD:238113 76/237 (32%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 76/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.