DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG34130

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:267 Identity:55/267 - (20%)
Similarity:95/267 - (35%) Gaps:89/267 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPA--DT 80
            |:.|.|.|.:.|:|:|        |..|          ||.|.:|..:.:|:|:|.:...:  ::
  Fly    49 TSGGHAVPWLLRIVDG--------PTFV----------CGASYLSALYALTSANCMHSHRSQMES 95

  Fly    81 LSIQFGVTNISAMG--------PNVVGIKKIIQHEDF---------------DPTRQNANDISLL 122
            ||::. |::.|...        ||.: |:.||..:|:               :..|.|.|:...|
  Fly    96 LSVEL-VSSDSRQDNQLDSHDPPNAL-IRNIIVSKDWHWPGTFMDVAVIELTNRLRGNRNNYVTL 158

  Fly   123 MVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLN-----DTYGS--VQDTLQEVSLK 180
            .......:..:||....      |.|..:...|.:.:   ||     ..||:  :::|:      
  Fly   159 CTNPLSSYKSLSVVSYG------AGPAENVRTEEIEV---LNRMICDSAYGNFLLRETV------ 208

  Fly   181 IYSDEECTSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPG 245
                 .|........|                |...:|.|:....|..|||:|| ..|..:..||
  Fly   209 -----ACAKEFKRSAD----------------CMFSAGCPVTAGDQLCGIVAWS-PACKRSNLPG 251

  Fly   246 VYCKVSQ 252
            ::..:.|
  Fly   252 IFTDIHQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 51/256 (20%)
Tryp_SPc 30..260 CDD:238113 50/255 (20%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 53/263 (20%)
Tryp_SPc 53..256 CDD:304450 52/259 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.