DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:271 Identity:96/271 - (35%)
Similarity:138/271 - (50%) Gaps:33/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IVILAVTTVGQAAPSIS---------RVVNGTDSSVLKYPFVVSLR-SYDGSHSCGGSIISKHFV 66
            :.:.|.|.|...|..::         |:.||..:...|.|::|.|. |.:|:..||||||...:|
  Fly     9 LAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWV 73

  Fly    67 MTAAHCTNGRPADTLSIQFGVT-NISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEF 130
            :||||||||  |..::|.:|.: .......:.||...||||..::....: |||||:.... .:|
  Fly    74 LTAAHCTNG--ASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLH-NDISLIRTPH-VDF 134

  Fly   131 DGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTY-GS-VQDTLQEVSLKIYSDEECT---SR 190
            ..: |..||||:..... |..||...|..|||  .|| || :.|.||.|.::|.|..:|:   |.
  Fly   135 WSL-VNKVELPSYNDRY-QDYAGWWAVASGWG--GTYDGSPLPDWLQSVDVQIISQSDCSRTWSL 195

  Fly   191 HNGQTDPKYHICGGVDEGGKGQCSGDSGGPLI-YNGQQ-VGIVSWSIKPCTVAPYPGVYCKVSQY 253
            |:..      ||...| |||..|.|||||||: ::|.: ||:.|:.......:..|.|:.:|:.|
  Fly   196 HDNM------ICINTD-GGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVTGY 253

  Fly   254 VDWIKSNQIIS 264
            :|||:.|..||
  Fly   254 LDWIRDNTGIS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 87/236 (37%)
Tryp_SPc 30..260 CDD:238113 88/238 (37%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 88/238 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.