DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and intr

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:143 Identity:33/143 - (23%)
Similarity:56/143 - (39%) Gaps:41/143 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLSLI--VILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAA 70
            ||.:|  .|..:.|.|||.....:.|.         .||:.: .|:....|.|::||...|:|:|
  Fly    73 SLEIIPAEIETLLTDGQATTEAPKAVK---------HFVMRI-LYENKVICSGALISTRLVLTSA 127

  Fly    71 HC----TNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLM----VEEP 127
            .|    ....|..:..:|...:.|.::...:.|.               ..|::||:    :|:|
  Fly   128 LCFPRTLRQPPPRSYKLQASRSRIYSVANLITGA---------------IEDMALLLLHAPLEDP 177

  Fly   128 FEFDGVSVAPVEL 140
            |      |.|::|
  Fly   178 F------VHPIDL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 25/120 (21%)
Tryp_SPc 30..260 CDD:238113 25/119 (21%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 21/94 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.