DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG31266

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:278 Identity:79/278 - (28%)
Similarity:131/278 - (47%) Gaps:39/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLSLIVILAVTTV----GQAAPSIS--------------RVVNGTDSSVLKYPFVVSLRSYDGS 53
            |.|:|:.:...|..    |:..|.::              ||:.||.::...:|::.|:::....
  Fly    11 LGLTLLALQGPTEAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYSY 75

  Fly    54 HSCGGSIISKHFVMTAAHCTNG-RPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNAN 117
            |.||..|:.:.:|:|||.|..| ||.:.|.:...|.......|... :.:|..|.:||....: |
  Fly    76 HLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYT-VSQIHVHCNFDKPLYH-N 138

  Fly   118 DISLLMVEEPFEFD----GVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVS 178
            ||:||.:....||:    .:::|.::         :.:.|.:....|||.::..|:....|||.|
  Fly   139 DIALLQLSSKIEFNDVTKNITLADID---------ELEEGDKLTFAGWGSSEAMGTYGRYLQEAS 194

  Fly   179 LKIYSDEECTSRHNGQTDPKY-HICGGVDEGGKGQCSGDSGGPLIYNGQQ-VGIVSWSIKPCTVA 241
            ......:.|..:...|.|... |:|..:| .|:|.|.||:|||||...|: |||.:|.: ||. .
  Fly   195 GTYLPVDACREKLQNQDDVDLGHVCVQMD-AGQGACHGDTGGPLIDEQQRLVGIGNWGV-PCG-R 256

  Fly   242 PYPGVYCKVSQYVDWIKS 259
            .||.||.:.:.|.|||::
  Fly   257 GYPDVYARTAFYHDWIRT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 71/234 (30%)
Tryp_SPc 30..260 CDD:238113 72/237 (30%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 71/234 (30%)
Tryp_SPc 52..275 CDD:238113 72/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.