DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG10405

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:273 Identity:87/273 - (31%)
Similarity:131/273 - (47%) Gaps:42/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLSLIVILAVTTVGQAAP--SISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTA 69
            |...::|||..:....|.|  ..||:|||.:::..::|:.:|||. ...|.||.||:|.::.:||
  Fly    12 LIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRR-QTVHICGASILSSNWAITA 75

  Fly    70 AHCTNG---RPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFD 131
            |||.:|   :|.:....|..:...|  |..|..:|.|.:|..:|....|. |::||...     |
  Fly    76 AHCIDGHEQQPREFTLRQGSIMRTS--GGTVQPVKAIYKHPAYDRADMNF-DVALLRTA-----D 132

  Fly   132 GV------SVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSV-QDTLQEVSLKIYSDEECTS 189
            |.      .|||:.||.:..|:.:|   :..|:.|||...|...| ...|:..::...:.|:|  
  Fly   133 GALSLPLGKVAPIRLPTVGEAISES---MPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKC-- 192

  Fly   190 RHNGQTDPKYHICGGVDEG-------GKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVY 247
             ||   |.::|  |||.|.       ....|.||||||:...|..:|||||.: .|....|||||
  Fly   193 -HN---DLRHH--GGVTEAMFCAAARNTDACQGDSGGPISAQGTLIGIVSWGV-GCADPYYPGVY 250

  Fly   248 CKVSQYV--DWIK 258
            .:::...  .||:
  Fly   251 TRLAHPTIRRWIR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 78/246 (32%)
Tryp_SPc 30..260 CDD:238113 79/248 (32%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 78/246 (32%)
Tryp_SPc 37..263 CDD:238113 78/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.