DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG10041

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:254 Identity:74/254 - (29%)
Similarity:119/254 - (46%) Gaps:29/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LAVTTVGQAAPSISRVVNGTDSSVLKYPFVVS----LRSYDGSHSCGGSIISKHFVMTAAHCTNG 75
            |..|||     |.::|:    |...:||::||    |:.| ..|.|.|.|:|..||::||||...
  Fly    33 LLATTV-----STTKVI----SFRPRYPYIVSIGENLKGY-YKHLCVGVILSNEFVLSAAHCIQT 87

  Fly    76 RPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVEL 140
            .|...|.:..|..::::.......:.:...|..|...  ..|||::|.:...|..|     .|..
  Fly    88 NPTKQLYVAGGADSLNSRKQTRFFVVERRWHPQFRVL--GGNDIAVLRIYPKFPLD-----DVRF 145

  Fly   141 PALAFA-VPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGG 204
            .::.|| .||.|:|.:..|:||| ....|.:: .|||:......::||...|.........||..
  Fly   146 RSINFAGKPQRDSGTQASLVGWG-RVGVGKIR-KLQEMPFLTMENDECQQSHRFVFLKPLDICAM 208

  Fly   205 VDEGGKGQCSGDSGGPLIYNGQQ--VGIVSWSIKPCT-VAPYPGVYCKVSQYVDWIKSN 260
            ..:|.:|.|.||||.||:...::  .|::|:..|.|| :.||  .:.:::.|..||:.:
  Fly   209 HLKGPRGPCDGDSGAPLMNVAKEKLYGLLSYGRKACTPLKPY--AFTRINAYSSWIQES 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 67/235 (29%)
Tryp_SPc 30..260 CDD:238113 69/237 (29%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 67/226 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447012
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.