DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Klk1c6

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_038942515.1 Gene:Klk1c6 / 408242 RGDID:1303220 Length:262 Species:Rattus norvegicus


Alignment Length:266 Identity:87/266 - (32%)
Similarity:129/266 - (48%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNG 75
            |.::|::..:..|.|..||||.|........|:.|::.|   ...|||.:|...:|:|||||.  
  Rat     6 LFLVLSMGRIDAAPPGQSRVVGGYKCEKNSQPWQVAVIS---RSLCGGVLIDPSWVITAAHCY-- 65

  Fly    76 RPADTLS---IQFGVTNISAMGP--NVVGIKKIIQHEDFDP------TRQ----NANDISLLMVE 125
              ::.||   :..|..|:|...|  ....:.:...|.|::|      |||    .:||:.||.:.
  Rat    66 --SNALSYYHVLLGRNNLSEDEPFAQYRFVSQSFPHPDYNPFFMRNHTRQPGDDYSNDLMLLHLS 128

  Fly   126 EPFEF-DGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYG-SVQDTLQEVSLKIYSDEECT 188
            :|.:. |||.|  ::||     ..:...|...:..|||...... .:.|.||.|::.:.|:|:|.
  Rat   129 KPADITDGVKV--IDLP-----TEEPKVGSTCLASGWGSTKPLDWELPDDLQCVNIHLLSNEKCI 186

  Fly   189 SRHNGQ-TDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQ 252
            ..:|.: ||  ..:|.|..||||..|.||||||||.:|...||.||...||.....|.:|.|:.:
  Rat   187 EAYNEKVTD--LMLCAGDLEGGKDTCKGDSGGPLICDGVLQGITSWGSDPCAEPNMPAIYTKLIK 249

  Fly   253 YVDWIK 258
            :..|||
  Rat   250 FTSWIK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 79/245 (32%)
Tryp_SPc 30..260 CDD:238113 81/247 (33%)
Klk1c6XP_038942515.1 Tryp_SPc 25..257 CDD:238113 81/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.