DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Klk4

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:255 Identity:79/255 - (30%)
Similarity:123/255 - (48%) Gaps:31/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VILAVTTVGQAAPSI-SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGR 76
            :||.||  |.:|.|| ||::.|.|......|:..:|.|.|.:..|.|.::...:|::||||..  
  Rat    16 LILEVT--GSSASSISSRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLSAAHCIQ-- 76

  Fly    77 PADTLSIQFGVTNISAM---GPNVVGIKKIIQHEDF-DPTRQNANDISLLMVEEP-FEFDGVSVA 136
              |:.::..|:.|:...   |..::.....|||.:: ||:  .|||:.|:.:.|. .|.:.:...
  Rat    77 --DSYTVGLGLHNLEGSQEPGSRMLEAHLSIQHPNYNDPS--FANDLMLIKLNESVMESNTIRRI 137

  Fly   137 PVELPALAFAVPQSDAGVEGVLIGWG-LNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYH 200
            ||     |...|  ..|...::.||| |.:  |.:...||.|:|.:.|:|.|...:    ||.||
  Rat   138 PV-----ASQCP--TPGDTCLVSGWGRLKN--GKLPSLLQCVNLSVASEETCRLLY----DPVYH 189

  Fly   201 I---CGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            :   |.|.....|..|:||||||::.|....|:||.....|.....|.||..:.::.:||
  Rat   190 LSMFCAGGGPDRKDTCNGDSGGPIVCNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 68/236 (29%)
Tryp_SPc 30..260 CDD:238113 69/237 (29%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 67/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.